Text Colour Changer
celtic cross celtic bird

YOU ARE HERE

Welcome to the Digital Art & Photography of Bruce White

Welcome to my digital art pages. I am not going to claim to be the most accomplished photographer or digital artist on the planet - but I'm learning. I have enjoyed the work so far; and have had some positive feedback, so I thought I would put up these few galleries for the wider world to view.

Most of the images on these pages were casual poses and chance photos. Other items are moments when the mind decided to run a bit freer then the average day. All images were spruced up with Photoshop 6 in someway or another. But rather then me waffling on, I will leave you to explore. Make up your own minds - 'artist' or 'more tablets doctor'? Whichever, I hope you enjoy the show.

pax et luv, bruce

eye of the beholder

Ladies and Gentlemen, to whom it concerns, au naturel, my
International Mates, Models & Miscreants

irelandmalaysiaswitzerlandswedenitalyfinlanddenmarkmexicohungaryenglandindiagreece

Other Parts of Bruce white

E-Mail

email

Guest Book

guestbook

icq status bar

ICQ # 159137158 to icq message center

Bruce White's other worlds:
~ Personal World ~ Genealogy World ~ Hercules World ~ Poetry World ~ Guest Book ~
Who is Bruce?
Le Hors D'oeuvre
A Few Introductory Images
Gallery ~ I
Abstracts
Gallery ~ II
Casual Portraits
Gallery ~ III
Two Tone Portraits
Gallery ~ IV
Scenes
Gallery ~ V
Moments 1
Gallery ~ VI
Moments 2
Gallery ~ VII
In Part
Gallery ~VIII
Animation
Gallery ~ IX
Le Femme
Gallery ~ X
Of Other Worlds
Gallery ~ XI
Seeing Double
Gallery XII
A few simple banner designs
 
back to last page visited to the hub of www.brucewhite.co.ukto next page in sequence

Webdesign by Bruce White

Bruce White © 2003 (All rights Reserved)

Celtic style Graphics are abased on originals by
Cari Buziak @ Aon Celtic Art

Copyright statement